PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v2112070.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HB-PHD
Protein Properties Length: 532aa    MW: 58917.3 Da    PI: 4.507
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v2112070.3genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox39.21.2e-12389439353
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                      +R+++ +  +++L + F+ n+yp+++++e LA++lgLt  qV  WF N R 
  Lj5g3v2112070.3 389 TRQRLGDVVVQRLHKSFKDNQYPDRATKESLAEELGLTFFQVDKWFGNARW 439
                      6778888889***************************************96 PP

2PHD42.61.3e-1457112151
                      SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
              PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                      +C++C+     ++++++lCdg C++ fH+ Cl+++l +e++p g   wlC+ C++k
  Lj5g3v2112070.3  57 FCSICQTkeLSTDNDIILCDGaCDRGFHQHCLDPPLLTEDIPPGdeGWLCPGCDCK 112
                      7******77778********66********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579036.2E-1447115IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.1E-1353112IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.17255112IPR019787Zinc finger, PHD-finger
CDDcd155043.11E-2857109No hitNo description
PfamPF006287.9E-1257112IPR019787Zinc finger, PHD-finger
SMARTSM002491.9E-1057110IPR001965Zinc finger, PHD-type
PROSITE patternPS01359058109IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.604.9E-15377438IPR009057Homeodomain-like
SuperFamilySSF466892.31E-14383447IPR009057Homeodomain-like
PROSITE profilePS5007114.171384444IPR001356Homeobox domain
SMARTSM003898.6E-15386448IPR001356Homeobox domain
PfamPF000464.4E-10389440IPR001356Homeobox domain
CDDcd000869.22E-14389445No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MDKLKPDKEI QRAKSEILRR KLKIRDLFQN LDSLCAEGKF PESLFDSEGE IDSEDIFCSI  60
CQTKELSTDN DIILCDGACD RGFHQHCLDP PLLTEDIPPG DEGWLCPGCD CKDDCVDLLN  120
DSLGTRLSLS DTWEKVFPEA AAVTGNNMDQ GLPSDDSDDD DYNPNGKEDV EVEGGESSSD  180
ESEYASASEK LEDSHHEDPY LGLPSEDSED NDYDPSAPDL DNKVTEESSS SDFTSDSEDL  240
AAAIEDNTSP GHVKQTKSRQ KSKVGKNPSM VDEVSSLREP ELEEEGFTPV SGKRNVERLD  300
YKKLYDETYK SDTSEDEEWT ASATPSRKKK LCGKMTPVSS DGKASNNSRH TPERNTQQDK  360
VENTNNSPTK SLEGCLESGS RDKKPRSSTR QRLGDVVVQR LHKSFKDNQY PDRATKESLA  420
EELGLTFFQV DKWFGNARWG FRRSSRMGAS PGEYASPQAT GSGPENTGER ERELASQEVG  480
EEKLKTPSPR KRKHLSEPQA SEAPQIIVLG LAASPGSPRA HAGNKKKTVK RK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.149320.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0061170.0AP006117.1 Lotus japonicus genomic DNA, chromosome 5, clone: LjT09H13, TM0200, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496910.10.0PREDICTED: homeobox protein HAT3.1
SwissprotQ049961e-112HAT31_ARATH; Homeobox protein HAT3.1
TrEMBLA0A0B2PGL90.0A0A0B2PGL9_GLYSO; Homeobox protein HAT3.1
STRINGGLYMA10G40641.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.12e-77Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain